Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL21 Peptide - middle region

RPL21 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252

UniProt

P46778

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL21 Rabbit Polyclonal Antibody (orb326524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000973

Preservative

Lyophilized powder

AA Sequence

QVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rora Mouse shRNA Plasmid (Locus ID 19883)
TG501915 1 Kit

Rora Mouse shRNA Plasmid (Locus ID 19883)

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, kappa Isotype Control
MBS4515199-01 20 Tests

PE/Cyanine7 Mouse IgM, kappa Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, kappa Isotype Control
MBS4515199-02 50 Tests

PE/Cyanine7 Mouse IgM, kappa Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, kappa Isotype Control
MBS4515199-03 100 Tests

PE/Cyanine7 Mouse IgM, kappa Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, kappa Isotype Control
MBS4515199-04 200 Tests

PE/Cyanine7 Mouse IgM, kappa Isotype Control

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgM, kappa Isotype Control
MBS4515199-05 5x 200 Tests

PE/Cyanine7 Mouse IgM, kappa Isotype Control

Sign In for Pricing
View Details