EDN3 Peptide - C-terminal region
EDN3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3
UniProt
Q7Z6D2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EDN3 Rabbit Polyclonal Antibody (orb584922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996915
Preservative
Lyophilized powder
AA Sequence
RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1968-100 1x 100 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), 0.2mg/mL
Sign In for Pricing
View Details 
#97500 1x 1 µmol
CF®505 Succinimidyl Ester (ATTO 488 Succinimidyl Ester)
Sign In for Pricing
View Details 
TRC-C102945-25MG 25 mg
1-(10-Chlorodecyl)-4-octylaminopyridinium chloride
Sign In for Pricing
View Details 
AP02558PU-S 50 µL
NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details