Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDN3 Peptide - C-terminal region

EDN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ET3, MGC15067, MGC61498, ET-3, WS4B, HSCR4, PPET3

UniProt

Q7Z6D2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EDN3 Rabbit Polyclonal Antibody (orb584922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996915

Preservative

Lyophilized powder

AA Sequence

RYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVRGANRGLCQRRLKSRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2M1 Rabbit Polyclonal Antibody
TA368912 100 µL

AP2M1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcein AM Assay Buffer
E-CK-A153 100 mL

Calcein AM Assay Buffer

Sign In for Pricing
View Details
1700024G13Rik Mouse Gene Knockout Kit (CRISPR)
KN500117 1 Kit

1700024G13Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSIP1 Mouse Monoclonal Antibody [Clone ID: 6E4]
AM06564SU-N 100 µL

PSIP1 Mouse Monoclonal Antibody [Clone ID: 6E4]

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL
BNC471761-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS711670 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details