DTNA Peptide - C-terminal region
DTNA Peptide - C-terminal region
Product Specifications
Product Name Alternative
D18S892E, DRP3, DTN, FLJ96209, LVNC1
UniProt
B4DIR0
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DTNA Rabbit Polyclonal Antibody (orb585026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001185871
Preservative
Lyophilized powder
AA Sequence
GATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ESP-H0005S-01 96 Tests
Human IL-1β (Interleukin 1β) solid ELISPOT Kit
Sign In for Pricing
View Details ESP-H0005S-02 5x 96 Tests
Human IL-1β (Interleukin 1β) solid ELISPOT Kit
Sign In for Pricing
View Details 
![Human IL-27 Recombinant Rabbit Monoclonal Antibody [PSH03-82] - BSA and Azide free (Capture)](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82a37/imageurl/ha722046.webp)
HA722046 100 µL
Human IL-27 Recombinant Rabbit Monoclonal Antibody [PSH03-82] - BSA and Azide free (Capture)
Sign In for Pricing
View Details