Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DTNA Peptide - C-terminal region

DTNA Peptide - C-terminal region

Product Specifications

Product Name Alternative

D18S892E, DRP3, DTN, FLJ96209, LVNC1

UniProt

B4DIR0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DTNA Rabbit Polyclonal Antibody (orb585026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001185871

Preservative

Lyophilized powder

AA Sequence

GATTSTMRGDMVTEDADPYVQPEDENYENDSVRQLENELQMEEYLKQKLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IkB alpha (S32/S36) Recombinant Rabbit Monoclonal Antibody [PSH06-76]
HA722770 100 µL

Phospho-IkB alpha (S32/S36) Recombinant Rabbit Monoclonal Antibody [PSH06-76]

Sign In for Pricing
View Details
Cantharidin
TRC-C175630-500MG 500 mg

Cantharidin

Sign In for Pricing
View Details
Mouse Smyd1 activation kit by CRISPRa
GA200434 1 Kit

Mouse Smyd1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytoskeletal Marker Antibody Sampler Kit
HAK21084 1 Kit

Cytoskeletal Marker Antibody Sampler Kit

Sign In for Pricing
View Details
GPR32 Antibody
8G335-AAT 50 µg

GPR32 Antibody

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF488A conjugate, 0.1mg/mL
BNC881633-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details