Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NQO2 Peptide - C-terminal region

NQO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DHQV, DIA6, NMOR2, QR2

UniProt

P16083

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NQO2 Rabbit Polyclonal Antibody (orb585037) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000895

Preservative

Lyophilized powder

AA Sequence

HFCGFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ADH5 sgRNA gene knockout kit - Lentiviral human ADH5 sgRNA gene knockout kit (25)
GTR15373344 1 Vial

Lentiviral human ADH5 sgRNA gene knockout kit - Lentiviral human ADH5 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
HEXB (NM_000521) Human Tagged ORF Clone Lentiviral Particle
RC200465L3V 200 µL

HEXB (NM_000521) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Chicken Arginyl tRNA protein transferase 1 (ATE1) ELISA kit
GTR10372899 96 Well

Chicken Arginyl tRNA protein transferase 1 (ATE1) ELISA kit

Sign In for Pricing
View Details
Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit
ELK7461MS-01 48 Tests

Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit

Sign In for Pricing
View Details
Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit
ELK7461MS-02 96 Tests

Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit

Sign In for Pricing
View Details
Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit
ELK7461MS-03 5x 96 Tests

Human TMEM176B (Transmembrane Protein 176B) Microsample ELISA Kit

Sign In for Pricing
View Details