Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NQO2 Peptide - C-terminal region

NQO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DHQV, DIA6, NMOR2, QR2

UniProt

P16083

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NQO2 Rabbit Polyclonal Antibody (orb585037) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000895

Preservative

Lyophilized powder

AA Sequence

HFCGFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXPH4 Antibody - N-terminal region : HRP (ARP53543_P050-HRP)
ARP53543_P050-HRP 100 µL

NXPH4 Antibody - N-terminal region : HRP (ARP53543_P050-HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal SMN Antibody [DyLight 680]
NBP1-03326FR 0.1 mL

Rabbit Polyclonal SMN Antibody [DyLight 680]

Sign In for Pricing
View Details
Dock2 3'UTR GFP Stable Cell Line
TU155318 1.0 mL

Dock2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb156751-01 50 μL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb156751-02 100 µL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA10 Rabbit Polyclonal Antibody
orb156751-03 200 µL

EPHA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details