Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAGAP Peptide - C-terminal region

TAGAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FKSG15, FLJ32631, FLJ39771, IDDM21, MGC133247, MGC27381, TAGAP1, ARHGAP47

UniProt

Q8N103

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TAGAP Rabbit Polyclonal Antibody (orb585239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_687034

Preservative

Lyophilized powder

AA Sequence

VHASGDSLGHVSGPGRPELLPLRTVSESVQRNKRDCLVRRCSQPVFEADQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLITRK6 Antibody
E55A06638 100 µg

Human SLITRK6 Antibody

Sign In for Pricing
View Details
Fidgetin (FIGN) (HRP)
MBS6269576-01 0.1 mL

Fidgetin (FIGN) (HRP)

Sign In for Pricing
View Details
Fidgetin (FIGN) (HRP)
MBS6269576-02 5x 0.1 mL

Fidgetin (FIGN) (HRP)

Sign In for Pricing
View Details
Trifluoroacetic acid-D >99.50 Atom % D (10x0.75ml) ampoule pack
DE150 10x 0.75 mL

Trifluoroacetic acid-D >99.50 Atom % D (10x0.75ml) ampoule pack

Sign In for Pricing
View Details
ICAM1/CD54 Mouse mAb, BF555 conjugated
orb3184443 100 µL

ICAM1/CD54 Mouse mAb, BF555 conjugated

Sign In for Pricing
View Details
Phosphatidylcholine translocator ABCB4
AP78768-01 50 µg

Phosphatidylcholine translocator ABCB4

Sign In for Pricing
View Details