Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1 Peptide - middle region

HLA-DPB1 Peptide - middle region

Product Specifications

Product Name Alternative

DPB1, HLA-DP1B

UniProt

P04440

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DPB1 Rabbit Polyclonal Antibody (orb585584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002112

Preservative

Lyophilized powder

AA Sequence

KRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2M1 Mouse Monoclonal Antibody [Clone ID: OTI1E9]
CF503019 100 µg

AP2M1 Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
Anti-Hu CD172g PE
1P-881-T100 100 Tests

Anti-Hu CD172g PE

Sign In for Pricing
View Details
Rat Protein Carbonyls (PCS) ELISA Kit
MBS3808923-01 48 Well

Rat Protein Carbonyls (PCS) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Carbonyls (PCS) ELISA Kit
MBS3808923-02 96 Well

Rat Protein Carbonyls (PCS) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Carbonyls (PCS) ELISA Kit
MBS3808923-03 5x 96 Well

Rat Protein Carbonyls (PCS) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Carbonyls (PCS) ELISA Kit
MBS3808923-04 10x 96 Well

Rat Protein Carbonyls (PCS) ELISA Kit

Sign In for Pricing
View Details