Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DPB1 Peptide - middle region

HLA-DPB1 Peptide - middle region

Product Specifications

Product Name Alternative

DPB1, HLA-DP1B

UniProt

P04440

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DPB1 Rabbit Polyclonal Antibody (orb585584) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002112

Preservative

Lyophilized powder

AA Sequence

KRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitocondrial Translational Initiation Factor 3 (MTIF3) Human Over-expression Lysate
orb1359585 20 µg

Mitocondrial Translational Initiation Factor 3 (MTIF3) Human Over-expression Lysate

Sign In for Pricing
View Details
KLC4 Antibody
A27016-100UG 100 µg

KLC4 Antibody

Sign In for Pricing
View Details
PAWR Recombinant Protein (Human)
RP082305 100 µg

PAWR Recombinant Protein (Human)

Sign In for Pricing
View Details
Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit
abx383775-01 96 Tests

Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit

Sign In for Pricing
View Details
Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit
abx383775-02 5x 96 Tests

Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit

Sign In for Pricing
View Details
Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit
abx383775-03 10x 96 Tests

Human Transducin-like enhancer protein 1 (TLE1) ELISA Kit

Sign In for Pricing
View Details