Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPP Peptide - C-terminal region

CLPP Peptide - C-terminal region

Product Specifications

UniProt

Q16740

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPP Rabbit Polyclonal Antibody (orb331220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006003

Preservative

Lyophilized powder

AA Sequence

EEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PDL1 (CD274) Protein (His-tag)
GB300602-H-10μg 10 μg

Recombinant Human PDL1 (CD274) Protein (His-tag)

Sign In for Pricing
View Details
KCTD15 Double Nickase Plasmid (h2)
sc-407663-NIC-2 20 µg

KCTD15 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)
FY-AB50070-01 1 mL

Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)

Sign In for Pricing
View Details
Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)
FY-AB50070-02 100 µL

Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)

Sign In for Pricing
View Details
Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)
FY-AB50070-03 200 µL

Anti-Endo Beta-N-Acetylglucosaminidase (ENGASE)

Sign In for Pricing
View Details
FAM3D Rabbit pAb
A17823-01 20 µL

FAM3D Rabbit pAb

Sign In for Pricing
View Details