Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLPP Peptide - C-terminal region

CLPP Peptide - C-terminal region

Product Specifications

UniProt

Q16740

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLPP Rabbit Polyclonal Antibody (orb331220) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006003

Preservative

Lyophilized powder

AA Sequence

EEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (4-Aminophenyl) -3- (piperidin-1-yl) propanamide
NEB54603-01 100 mg

N- (4-Aminophenyl) -3- (piperidin-1-yl) propanamide

Sign In for Pricing
View Details
N- (4-Aminophenyl) -3- (piperidin-1-yl) propanamide
NEB54603-02 1 g

N- (4-Aminophenyl) -3- (piperidin-1-yl) propanamide

Sign In for Pricing
View Details
MYSA AAV siRNA Pooled Vector
31338161 1.0 µg

MYSA AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Fish Asialoglycoprotein Receptor 2 ELISA Kit
MBS105529 Inquire

Fish Asialoglycoprotein Receptor 2 ELISA Kit

Sign In for Pricing
View Details
Anti-MLF2 antibody
STJ190997 200 µl

Anti-MLF2 antibody

Sign In for Pricing
View Details
ISM2 Rabbit pAb
orb2708444-01 50 µL

ISM2 Rabbit pAb

Sign In for Pricing
View Details