Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNB2 Peptide - N-terminal region

CCNB2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HsT17299

UniProt

O95067

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNB2 Rabbit Polyclonal Antibody (orb585633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004692

Preservative

Lyophilized powder

AA Sequence

IGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC / DP2.5 rat monoclonal antibody, clone KT44, Aff - Purified
AM20825PU-S 100 µg

APC / DP2.5 rat monoclonal antibody, clone KT44, Aff - Purified

Sign In for Pricing
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-01 0.02 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-02 0.1 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)
MBS7034592-03 5x 0.1 mg

Recombinant Burkholderia multivorans Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
ABCC5 Antibody (HRP)
orb415346-01 50 µg

ABCC5 Antibody (HRP)

Sign In for Pricing
View Details
ABCC5 Antibody (HRP)
orb415346-02 100 µg

ABCC5 Antibody (HRP)

Sign In for Pricing
View Details