Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASB1 Peptide - C-terminal region

ASB1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ASB-1

UniProt

Q9Y576

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ASB1 Rabbit Polyclonal Antibody (orb586097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

BAA86460

Preservative

Lyophilized powder

AA Sequence

PGCVMDAVLRHGCEAAFVSLLVEFGANLNLVKWESLGPESRGRRKVDPEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APP
RA18003 100 µL

APP

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)
MBS1244751-01 0.02 mg (E-Coli)

Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)
MBS1244751-02 0.1 mg (E-Coli)

Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)
MBS1244751-03 0.02 mg (Yeast)

Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)
MBS1244751-04 0.1 mg (Yeast)

Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details
Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)
MBS1244751-05 0.02 mg (Baculovirus)

Recombinant Magnetococcus sp. Urease accessory protein UreF (ureF)

Sign In for Pricing
View Details