Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG11A Peptide - N-terminal region

SPAG11A Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDDM2A, HE2

UniProt

Q6PDA7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG11A Rabbit Polyclonal Antibody (orb586101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075021

Preservative

Lyophilized powder

AA Sequence

LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine
PC1018713-01 250 mg

5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine
PC1018713-02 500 mg

5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine

Sign In for Pricing
View Details
5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine
PC1018713-03 1 g

5- (2-Fluoro-4- (trifluoromethyl) phenyl) thiazol-2-amine

Sign In for Pricing
View Details
Map3k2, NT (Map3k2, Mekk2, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2) (MaxLight 550) discontinued
038146-ML550 100 µL

Map3k2, NT (Map3k2, Mekk2, Mitogen-activated protein kinase kinase kinase 2, MAPK/ERK kinase kinase 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Phospho-NFAT2 (Ser233) Rabbit Polyclonal Antibody (FITC)
orb502756 100 µL

Phospho-NFAT2 (Ser233) Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CRSP70 Polyclonal Antibody
ABP57046-01 30 µL

CRSP70 Polyclonal Antibody

Sign In for Pricing
View Details