Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPAG11A Peptide - N-terminal region

SPAG11A Peptide - N-terminal region

Product Specifications

Product Name Alternative

EDDM2A, HE2

UniProt

Q6PDA7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPAG11A Rabbit Polyclonal Antibody (orb586101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001075021

Preservative

Lyophilized powder

AA Sequence

LFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-01 0.1 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-02 0.2 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-03 0.5 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-04 1 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-05 5 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
MBS2107364-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details