Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EI24 Peptide - N-terminal region

EI24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PIG8, TP53I8

UniProt

O14681

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EI24 Rabbit Polyclonal Antibody (orb586114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007278

Preservative

Lyophilized powder

AA Sequence

ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HECTD2 Peptide - middle region
MBS3231858-01 0.1 mg

HECTD2 Peptide - middle region

Sign In for Pricing
View Details
HECTD2 Peptide - middle region
MBS3231858-02 5x 0.1 mg

HECTD2 Peptide - middle region

Sign In for Pricing
View Details
1-[3- (Pyrrolidin-1-yl) propyl]-1H-pyrazol-3-amine
ZZB32061-01 50 mg

1-[3- (Pyrrolidin-1-yl) propyl]-1H-pyrazol-3-amine

Sign In for Pricing
View Details
1-[3- (Pyrrolidin-1-yl) propyl]-1H-pyrazol-3-amine
ZZB32061-02 0.5 g

1-[3- (Pyrrolidin-1-yl) propyl]-1H-pyrazol-3-amine

Sign In for Pricing
View Details
CD123 Recombinant Protein
NCP0173-01 500 µg

CD123 Recombinant Protein

Sign In for Pricing
View Details
CD123 Recombinant Protein
NCP0173-02 1 mg

CD123 Recombinant Protein

Sign In for Pricing
View Details