Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EI24 Peptide - N-terminal region

EI24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PIG8, TP53I8

UniProt

O14681

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EI24 Rabbit Polyclonal Antibody (orb586114) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007278

Preservative

Lyophilized powder

AA Sequence

ICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT2 Rabbit Polyclonal Antibody
53330-01 50 µL

FUT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FUT2 Rabbit Polyclonal Antibody
53330-02 100 µL

FUT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)
MBS7008991-01 0.02 mg

Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)
MBS7008991-02 0.1 mg

Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)
MBS7008991-03 5x 0.1 mg

Recombinant Vibrio cholerae serotype O1 ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
4- (2-Chloro-5-fluorophenyl) piperidine hydrochloride
PC402112 1 Each

4- (2-Chloro-5-fluorophenyl) piperidine hydrochloride

Sign In for Pricing
View Details