GNA11 Peptide - N-terminal region
GNA11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GNA-11
UniProt
P43444
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GNA11 Rabbit Polyclonal Antibody (orb586118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002058
Preservative
Lyophilized powder
AA Sequence
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470270-100 1x 100 µL
Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740630-500 1x 500 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400713-500 1x 500 µL
MyoD1 (5.8A + MYD712), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882230-500 1x 500 µL
FOXA1 / HNF3A (FOXA1/2230R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402970-500 1x 500 µL
MUC2 (Mucin 2) (MLP/2970R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details