Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT4 Peptide - N-terminal region

KRT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CK4, CYK4, FLJ31692, K4, CK-4

UniProt

F8VS64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT4 Rabbit Polyclonal Antibody (orb586121) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002263

Preservative

Lyophilized powder

AA Sequence

SGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PSF1 Antibody [Janelia Fluor 646]
NBP2-30366JF646 0.1 mL

Rabbit Polyclonal PSF1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
IL12A Polyclonal Antibody, HRP Conjugated
bs-14637R-HRP 100 µL

IL12A Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Eosin Blue Agar Plates
30629139-5 80 Plates

Eosin Blue Agar Plates

Sign In for Pricing
View Details
RGD1562720-set siRNA/shRNA/RNAi Lentivector (Rat)
39300096 4x 500 ng

RGD1562720-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal XCL1/Lymphotactin Antibody (MM0604-4G24) [HRP]
NBP2-12004H 0.1 mL

Mouse Monoclonal XCL1/Lymphotactin Antibody (MM0604-4G24) [HRP]

Sign In for Pricing
View Details
Lentiviral mouse Slc4a9 shRNA (UAS) - Lentiviral mouse Slc4a9 shRNA (UAS, iRFP) (25)
GTR15305105 1 Vial

Lentiviral mouse Slc4a9 shRNA (UAS) - Lentiviral mouse Slc4a9 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details