Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT4 Peptide - N-terminal region

KRT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CK4, CYK4, FLJ31692, K4, CK-4

UniProt

F8VS64

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT4 Rabbit Polyclonal Antibody (orb586121) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002263

Preservative

Lyophilized powder

AA Sequence

SGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse IgG for WB, AlpSdAbs® VHH (HRP)
HA710356 100 µg

Anti-Mouse IgG for WB, AlpSdAbs® VHH (HRP)

Sign In for Pricing
View Details
GNAI2 (Guanine Nucleotide-binding Protein G (i) Subunit alpha-2, Adenylate Cyclase-inhibiting G alpha Protein, GNAI2B)
127415 100 µg

GNAI2 (Guanine Nucleotide-binding Protein G (i) Subunit alpha-2, Adenylate Cyclase-inhibiting G alpha Protein, GNAI2B)

Sign In for Pricing
View Details
Recombinant Human LPIN1 Protein
E30P10624 20 µg

Recombinant Human LPIN1 Protein

Sign In for Pricing
View Details
Mouse CML1 shRNA Plasmid
abx975409-01 150 µg

Mouse CML1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CML1 shRNA Plasmid
abx975409-02 300 µg

Mouse CML1 shRNA Plasmid

Sign In for Pricing
View Details
EGR1 (NM_001964) Human Untagged Clone
SC128132 10 µg

EGR1 (NM_001964) Human Untagged Clone

Sign In for Pricing
View Details