Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGFRN Peptide - C-terminal region

PTGFRN Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD315, CD9P-1, EWI-F, FLJ11001, FPRP, KIAA1436, SMAP-6

UniProt

Q9P2B2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTGFRN Rabbit Polyclonal Antibody (orb331302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_065173

Preservative

Lyophilized powder

AA Sequence

SWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ATP1A1 (Ser23) Antibody
A72908-100UL 100 µL

Phospho-ATP1A1 (Ser23) Antibody

Sign In for Pricing
View Details
LCMT2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
26374111 3x 1.0 µg

LCMT2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
HGF Protein Lysate (Rat) with C-HA Tag
23234036 100 µg

HGF Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
NDUFB4 Rabbit mAb
RDSA66362 100 µL

NDUFB4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 2 subtype B Protein Nef (nef)
MBS1103251-01 0.02 mg (E-Coli)

Recombinant Human immunodeficiency virus type 2 subtype B Protein Nef (nef)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 2 subtype B Protein Nef (nef)
MBS1103251-02 0.1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 2 subtype B Protein Nef (nef)

Sign In for Pricing
View Details