Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERP1 Peptide - N-terminal region

SERP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117327, MGC133321, MGC133322, RAMP4

UniProt

Q9Y6X1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERP1 Rabbit Polyclonal Antibody (orb586126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055260

Preservative

Lyophilized powder

AA Sequence

IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(8R,9R)-8,9-Dihydrobenz[a]anthracene-8,9-diol Dibenzoate
TRC-D452985-5MG 5 mg

(8R,9R)-8,9-Dihydrobenz[a]anthracene-8,9-diol Dibenzoate

Sign In for Pricing
View Details
Spem1 Mouse Gene Knockout Kit (CRISPR)
KN516592 1 Kit

Spem1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), 1mg/mL
BNUM0218-50 1x 50 µL

CD100 (Semaphorin-4D) (A8), 1mg/mL

Sign In for Pricing
View Details
Human LRCOL1 activation kit by CRISPRa
GA119313 1 Kit

Human LRCOL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS806801 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Nestin (Cancer Stem Cell Marker) (NES/2911), CF640R conjugate, 0.1mg/mL
BNC402911-100 1x 100 µL

Nestin (Cancer Stem Cell Marker) (NES/2911), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details