Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERP1 Peptide - N-terminal region

SERP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117327, MGC133321, MGC133322, RAMP4

UniProt

Q9Y6X1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERP1 Rabbit Polyclonal Antibody (orb586126) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055260

Preservative

Lyophilized powder

AA Sequence

IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-01 20 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-02 100 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-03 500 µg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)
PDMH100444-04 1 mg

Recombinant Human ANGPTL4 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF488A conjugate, 0.1mg/mL
BNC882058-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/2058R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXA1 Mouse Monoclonal Antibody [A2E9]
HA600022 100 µL

FOXA1 Mouse Monoclonal Antibody [A2E9]

Sign In for Pricing
View Details