Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIL1 Peptide - C-terminal region

VIL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D2S1471, VIL

UniProt

P09327

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VIL1 Rabbit Polyclonal Antibody (orb586129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009058

Preservative

Lyophilized powder

AA Sequence

KPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPPR2 (PLPPR2) (NM_022737) Human Over-expression Lysate
LC402938 20 µg

LPPR2 (PLPPR2) (NM_022737) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Ala Wang Resin
H0370751301.25G 25 g

Fmoc-Ala Wang Resin

Sign In for Pricing
View Details
Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF405S conjugate, 0.1mg/mL
BNC042113-500 1x 500 µL

Involucrin (Squamous Cell Terminal Differentiation Marker) (IVRN/2113R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNMA1 Rabbit Polyclonal Antibody
AP20653PU-N 100 µg

KCNMA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
rac-Kavain-d3
TRC-K145492-5MG 5 mg

rac-Kavain-d3

Sign In for Pricing
View Details
Ankra2 Mouse Gene Knockout Kit (CRISPR)
KN501261 1 Kit

Ankra2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details