Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VIL1 Peptide - C-terminal region

VIL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D2S1471, VIL

UniProt

P09327

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with VIL1 Rabbit Polyclonal Antibody (orb586129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009058

Preservative

Lyophilized powder

AA Sequence

KPVEELPEGVDPSRKEEHLSIEDFTQAFGMTPAAFSALPRWKQQNLKKEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Perfluorohexyl)ethyl Thiocyanate
TRC-P286330-500MG 500 mg

2-(Perfluorohexyl)ethyl Thiocyanate

Sign In for Pricing
View Details
1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12
TRC-B585428-5MG 5 mg

1,2-Bis(2,4,6-tribromophenoxy)ethane-13C12

Sign In for Pricing
View Details
CD2 Rabbit Monoclonal Antibody
TA423891 100 µL

CD2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
GM130 Antibody
KC-3904-01 50 μL

GM130 Antibody

Sign In for Pricing
View Details
GM130 Antibody
KC-3904-02 100 µL

GM130 Antibody

Sign In for Pricing
View Details
GM130 Antibody
KC-3904-03 1 mL

GM130 Antibody

Sign In for Pricing
View Details