Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPG1 Peptide - C-terminal region

IMPG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GP147, IPM150, SPACR

UniProt

Q17R60

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMPG1 Rabbit Polyclonal Antibody (orb586136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001554

Preservative

Lyophilized powder

AA Sequence

TKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC37A16P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV732269 1.0 µg DNA

LRRC37A16P Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Varicella-Zoster Virus (VZV) (MaxLight 405)
MBS6188253-01 0.1 mL

Varicella-Zoster Virus (VZV) (MaxLight 405)

Sign In for Pricing
View Details
Varicella-Zoster Virus (VZV) (MaxLight 405)
MBS6188253-02 5x 0.1 mL

Varicella-Zoster Virus (VZV) (MaxLight 405)

Sign In for Pricing
View Details
ZNF577 antibody - C-terminal region
MBS3202931-01 0.1 mL

ZNF577 antibody - C-terminal region

Sign In for Pricing
View Details
ZNF577 antibody - C-terminal region
MBS3202931-02 5x 0.1 mL

ZNF577 antibody - C-terminal region

Sign In for Pricing
View Details
GAD2 Antibody : HRP (OAAF01803-HRP)
OAAF01803-100UG-HRP 100 µg

GAD2 Antibody : HRP (OAAF01803-HRP)

Sign In for Pricing
View Details