Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IMPG1 Peptide - C-terminal region

IMPG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GP147, IPM150, SPACR

UniProt

Q17R60

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IMPG1 Rabbit Polyclonal Antibody (orb586136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001554

Preservative

Lyophilized powder

AA Sequence

TKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Interleukin 5 Receptor Alpha (IL5Ra)
RPU57954-01 50 µg

Recombinant Interleukin 5 Receptor Alpha (IL5Ra)

Sign In for Pricing
View Details
Recombinant Interleukin 5 Receptor Alpha (IL5Ra)
RPU57954-02 100 µg

Recombinant Interleukin 5 Receptor Alpha (IL5Ra)

Sign In for Pricing
View Details
Recombinant Interleukin 5 Receptor Alpha (IL5Ra)
RPU57954-03 1 mg

Recombinant Interleukin 5 Receptor Alpha (IL5Ra)

Sign In for Pricing
View Details
Smoothelin-Like Protein 1 (SMTNL1) Antibody
abx376645-01 50 µg

Smoothelin-Like Protein 1 (SMTNL1) Antibody

Sign In for Pricing
View Details
Smoothelin-Like Protein 1 (SMTNL1) Antibody
abx376645-02 100 µg

Smoothelin-Like Protein 1 (SMTNL1) Antibody

Sign In for Pricing
View Details
Cxcl5 ORF Vector (Mouse) (pORF)
17177014 1.0 µg DNA

Cxcl5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details