Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPP4 Peptide - C-terminal region

MPP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALS2CR5, DLG6

UniProt

Q96JB8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPP4 Rabbit Polyclonal Antibody (orb586137) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149055

Preservative

Lyophilized powder

AA Sequence

GPSGVGVNELRRQLIEFNPSHFQSAVPHTTRTKKSYEMNGREYHYVSKET

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIG121 Rabbit pAb, AP conjugated
orb2881404 100 µL

EIG121 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Mouse Monoclonal BAK Antibody (AT38E2)
NBP1-74026-100ul 100 µL

Mouse Monoclonal BAK Antibody (AT38E2)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)
orb2930318-01 20 µg

Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)
orb2930318-02 100 µg

Recombinant Thermosynechococcus elongatus ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Rabbit Monoclonal SOD2/Mn-SOD Antibody (012) [DyLight 680]
NBP2-90139FR 0.1 mL

Rabbit Monoclonal SOD2/Mn-SOD Antibody (012) [DyLight 680]

Sign In for Pricing
View Details
Tnfrsf19 (NM_001164155) Mouse Tagged Lenti ORF Clone
MR225324L4 10 µg

Tnfrsf19 (NM_001164155) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details