Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt2 Peptide - C-terminal region

Wnt2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610510E18Rik, Int1l1, Irp, Mirp, Wnt-2, Wnt2a

UniProt

P21552

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt2 Rabbit Polyclonal Antibody (orb574058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076142

Preservative

Lyophilized powder

AA Sequence

RKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant p53 (phospho S6) Antibody
RC-5582-01 50 μL

Recombinant p53 (phospho S6) Antibody

Sign In for Pricing
View Details
Recombinant p53 (phospho S6) Antibody
RC-5582-02 100 µL

Recombinant p53 (phospho S6) Antibody

Sign In for Pricing
View Details
Recombinant p53 (phospho S6) Antibody
RC-5582-03 1 mL

Recombinant p53 (phospho S6) Antibody

Sign In for Pricing
View Details
2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride
TRC-M725060-10MG 10 mg

2-(4-Morpholinyl)ethyl 1-Phenylcyclohexane Carboxylate Hydrochloride

Sign In for Pricing
View Details
Myelin expression factor 2 (MYEF2) Rabbit Polyclonal Antibody
TA370769 100 µL

Myelin expression factor 2 (MYEF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bis-Biphenyl-4-yl-amine
TRC-B412968-50MG 50 mg

Bis-Biphenyl-4-yl-amine

Sign In for Pricing
View Details