Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt2 Peptide - C-terminal region

Wnt2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610510E18Rik, Int1l1, Irp, Mirp, Wnt-2, Wnt2a

UniProt

P21552

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt2 Rabbit Polyclonal Antibody (orb574058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076142

Preservative

Lyophilized powder

AA Sequence

RKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMA16 Antibody
KC-21143-01 50 μL

TMA16 Antibody

Sign In for Pricing
View Details
TMA16 Antibody
KC-21143-02 100 µL

TMA16 Antibody

Sign In for Pricing
View Details
TMA16 Antibody
KC-21143-03 1 mL

TMA16 Antibody

Sign In for Pricing
View Details
CD61 (ITGB3) (NM_000212) Human Recombinant Protein
TP321606L 1 mg

CD61 (ITGB3) (NM_000212) Human Recombinant Protein

Sign In for Pricing
View Details
S1P Receptor EDG1 (Ab-236) Antibody
8B1180-AAT 50 µg

S1P Receptor EDG1 (Ab-236) Antibody

Sign In for Pricing
View Details
Medronic Acid
TRC-M203500-50MG 50 mg

Medronic Acid

Sign In for Pricing
View Details