Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tank Peptide - N-terminal region

Tank Peptide - N-terminal region

Product Specifications

UniProt

Q8VDA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tank Rabbit Polyclonal Antibody (orb574117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665731

Preservative

Lyophilized powder

AA Sequence

MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Botulinum rpsF Protein (aa 1-94) (strain Loch Maree / Type A3)
VAng-Lsx8675-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Botulinum rpsF Protein (aa 1-94) (strain Loch Maree / Type A3)

Sign In for Pricing
View Details
CABC1 (Chaperone-activity of bc1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, MGC4849, PP265) (MaxLight 405) discontinued
124198-ML405 100 µL

CABC1 (Chaperone-activity of bc1 Complex-like, Mitochondrial, Chaperone-ABC1-like, aarF Domain-containing Protein Kinase 3, ADCK3, MGC4849, PP265) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MTRR Polyclonal Conjugated Antibody
orb1627880 100 µL

MTRR Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human Cyclin H (CCNH) ELISA kit
GTR10424540 96 Well

Human Cyclin H (CCNH) ELISA kit

Sign In for Pricing
View Details
Smad6 (D-4)
sc-25321 200 µg/mL

Smad6 (D-4)

Sign In for Pricing
View Details
CCL23 Antibody
CSB-PA962305-01 50 μL

CCL23 Antibody

Sign In for Pricing
View Details