Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tank Peptide - N-terminal region

Tank Peptide - N-terminal region

Product Specifications

UniProt

Q8VDA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tank Rabbit Polyclonal Antibody (orb574117) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_665731

Preservative

Lyophilized powder

AA Sequence

MDKNIGEQLNRAYEAFRQACMDRDSAVRELQQKQTENYEQRIREQQEQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPPA4 sgRNA CRISPR Lentivector (Human) (Target 1)
K0628802 1.0 µg DNA

DPPA4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MIIP siRNA (Human)
CRJ1823-01 15 nmol

MIIP siRNA (Human)

Sign In for Pricing
View Details
MIIP siRNA (Human)
CRJ1823-02 30 nmol

MIIP siRNA (Human)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)
MBS9423173-01 0.01 mg

Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)
MBS9423173-02 0.1 mg

Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)
MBS9423173-03 0.25 mg

Recombinant Rhesus Macaque Amyloid protein A protein (SAA1)

Sign In for Pricing
View Details