Fam189b Peptide - C-terminal region
Fam189b Peptide - C-terminal region
Product Specifications
Product Name Alternative
1110013L07Rik
UniProt
Q5HZJ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fam189b Rabbit Polyclonal Antibody (orb324517) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001014995
Preservative
Lyophilized powder
AA Sequence
LYTKVLEEEAASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680460-500 1x 500 µL
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942152-500 1x 500 µL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041953-500 1x 500 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details