Elk3 Peptide - N-terminal region
Elk3 Peptide - N-terminal region
Product Specifications
UniProt
D4A9V6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Elk3 Rabbit Polyclonal Antibody (orb575127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001102213
Preservative
Lyophilized powder
AA Sequence
KTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPDILKMDPHAVEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA328554 50 µg
Biotinylated Anti-Murine Resistin Goat Polyclonal Antibody
Sign In for Pricing
View Details 
042620-PE 200 µL
TATDN1, ID (TATDN1, Putative deoxyribonuclease TATDN1, Hepatocarcinoma high expression protein) (PE) discontinued
Sign In for Pricing
View Details 113201D2-AAT 500 Tests
APC/XFD750 Anti-human/ dog CD132 Antibody *TUGh4*
Sign In for Pricing
View Details K6487704 1.0 µg DNA
Sgsm2 sgRNA CRISPR Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details GTR15339272 1 Vial
Lentiviral human GTF2E1 shRNA (UAS) - Lentiviral human GTF2E1 shRNA (UAS) (25)
Sign In for Pricing
View Details