Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Elk3 Peptide - N-terminal region

Elk3 Peptide - N-terminal region

Product Specifications

UniProt

D4A9V6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Elk3 Rabbit Polyclonal Antibody (orb575127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102213

Preservative

Lyophilized powder

AA Sequence

KTNMNYDKLSRALRYYYDKNIIKKVIGQKFVYKFVSFPDILKMDPHAVEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

γ Enolase (D-7) P
sc-376375 P 100 µg - 0.5 mL

γ Enolase (D-7) P

Sign In for Pricing
View Details
3,5-Diamino-6-chloropyrazine-2-carboxylic Acid
TRC-D416455-50MG 50 mg

3,5-Diamino-6-chloropyrazine-2-carboxylic Acid

Sign In for Pricing
View Details
Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit
MBS457235-01 48 Tests

Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit

Sign In for Pricing
View Details
Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit
MBS457235-02 96 Tests

Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit

Sign In for Pricing
View Details
Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit
MBS457235-03 5x 96 Tests

Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit

Sign In for Pricing
View Details
Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit
MBS457235-04 10x 96 Tests

Human Very Low Density Lipoprotein Receptor (VLDLR) ELISA Kit

Sign In for Pricing
View Details