Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Peptide - N-terminal region

Cnot8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1500015I04Rik, 1810022F04Rik, AA536816, AU015770, AU043059

UniProt

Q9D8X5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cnot8 Rabbit Polyclonal Antibody (orb576713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081225

Preservative

Lyophilized powder

AA Sequence

VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cdkn1b activation kit by CRISPRa
GA200677 1 Kit

Mouse Cdkn1b activation kit by CRISPRa

Sign In for Pricing
View Details
ENSA (NM_207168) Human Over-expression Lysate
LC404060 20 µg

ENSA (NM_207168) Human Over-expression Lysate

Sign In for Pricing
View Details
Zbtb25 Mouse Gene Knockout Kit (CRISPR)
KN519602 1 Kit

Zbtb25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant alpha Tubulin Monoclonal Antibody
E-AB-81458-01 50 µL

Recombinant alpha Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant alpha Tubulin Monoclonal Antibody
E-AB-81458-02 100 µL

Recombinant alpha Tubulin Monoclonal Antibody

Sign In for Pricing
View Details
TLR4 Rabbit Polyclonal Antibody
AP20612PU-N 100 µg

TLR4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details