Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cnot8 Peptide - N-terminal region

Cnot8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1500015I04Rik, 1810022F04Rik, AA536816, AU015770, AU043059

UniProt

Q9D8X5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cnot8 Rabbit Polyclonal Antibody (orb576713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081225

Preservative

Lyophilized powder

AA Sequence

VWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP2 Human Gene Knockout Kit (CRISPR)
KN213707LP 1 Kit

LRP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF146 Human Gene Knockout Kit (CRISPR)
KN420814 1 Kit

ZNF146 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FAM189A1 activation kit by CRISPRa
GA108247 1 Kit

Human FAM189A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human NCAM1 / CD56 Recombinant Rabbit monoclonal Antibody
HA720215F 100 µL

Human NCAM1 / CD56 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR563026 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), 0.2mg/mL
BNUB1746-500 1x 500 µL

Human Herpes Virus 8 (HHV8) (LN53), 0.2mg/mL

Sign In for Pricing
View Details