Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo2 Peptide - C-terminal region

Lmo2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rbtn-2, Rbtn2, Rhom-2, Ttg2

UniProt

A2BHP5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo2 Rabbit Polyclonal Antibody (orb576770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135807

Preservative

Lyophilized powder

AA Sequence

RRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pam16 (NM_025571) Mouse Tagged ORF Clone
MG200652 10 µg

Pam16 (NM_025571) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF594 conjugate, 0.1mg/mL
BNC942424-500 1x 500 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPATA7 (C-term) Rabbit Polyclonal Antibody
AP54003PU-N 400 µL

SPATA7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Exifone
TRC-E958200-500MG 500 mg

Exifone

Sign In for Pricing
View Details
Ngf Mouse Gene Knockout Kit (CRISPR)
KN310963RB 1 Kit

Ngf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), 0.2mg/mL
BNUB0892-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), 0.2mg/mL

Sign In for Pricing
View Details