Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo2 Peptide - C-terminal region

Lmo2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Rbtn-2, Rbtn2, Rhom-2, Ttg2

UniProt

A2BHP5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lmo2 Rabbit Polyclonal Antibody (orb576770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001135807

Preservative

Lyophilized powder

AA Sequence

RRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLA1 Polyclonal Antibody
E-AB-18707-01 20 µL

OLA1 Polyclonal Antibody

Sign In for Pricing
View Details
OLA1 Polyclonal Antibody
E-AB-18707-02 60 µL

OLA1 Polyclonal Antibody

Sign In for Pricing
View Details
OLA1 Polyclonal Antibody
E-AB-18707-03 120 µL

OLA1 Polyclonal Antibody

Sign In for Pricing
View Details
OLA1 Polyclonal Antibody
E-AB-18707-04 200 µL

OLA1 Polyclonal Antibody

Sign In for Pricing
View Details
Bitertanol
TRC-B386500-1G 1 g

Bitertanol

Sign In for Pricing
View Details
CD36 (NM_001001547) Human Over-expression Lysate
LC424372 20 µg

CD36 (NM_001001547) Human Over-expression Lysate

Sign In for Pricing
View Details