Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea1 Peptide - C-terminal region

Tcea1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC116288

UniProt

Q4KLL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea1 Rabbit Polyclonal Antibody (orb576861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020906

Preservative

Lyophilized powder

AA Sequence

TAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF594 conjugate, 0.1mg/mL
BNC942045-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Hsp27/HSPB1 Antibody, Rabbit Polyclonal
MBS8102423-01 0.1 mL

Anti-Hsp27/HSPB1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Hsp27/HSPB1 Antibody, Rabbit Polyclonal
MBS8102423-02 5x 0.1 mL

Anti-Hsp27/HSPB1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
GC
CSB-CL009306HU 10 μg Plasmid + 200 μL Glycerol

GC

Sign In for Pricing
View Details
1- (2-Chloropyridin-4-yl) ethan-1-amine
KSB81199-01 100 mg

1- (2-Chloropyridin-4-yl) ethan-1-amine

Sign In for Pricing
View Details
1- (2-Chloropyridin-4-yl) ethan-1-amine
KSB81199-02 1 g

1- (2-Chloropyridin-4-yl) ethan-1-amine

Sign In for Pricing
View Details