Rorb Peptide - N-terminal region
Rorb Peptide - N-terminal region
Product Specifications
UniProt
F1LQ88
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rorb Rabbit Polyclonal Antibody (orb576867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_002725756
Preservative
Lyophilized powder
AA Sequence
SSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNRNRCQHCR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1051613-01 0.02 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1051613-02 0.1 mg (E-Coli)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1051613-03 0.02 mg (Yeast)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1051613-04 0.1 mg (Yeast)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1051613-05 0.02 mg (Baculovirus)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details MBS1051613-06 0.02 mg (Mammalian-Cell)
Recombinant Campylobacter jejuni subsp.jejuni serotype O:23/36 SsrA-binding protein (smpB)
Sign In for Pricing
View Details