Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlx1 Peptide - C-terminal region

Dlx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC189409

UniProt

G3V669

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlx1 Rabbit Polyclonal Antibody (orb577401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094001

Preservative

Lyophilized powder

AA Sequence

SAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Feline 2-Plex ELISA Kits-cTnT/PAPP-A
GR227071 96 Well

Nori® Feline 2-Plex ELISA Kits-cTnT/PAPP-A

Sign In for Pricing
View Details
Diaph1 Protein Vector (Human) (pPM-C-HA)
18218021 500 ng

Diaph1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
OKCA01960-96W - LPL ELISA Kit (Sheep)
OKCA01960-96W 96 Well

OKCA01960-96W - LPL ELISA Kit (Sheep)

Sign In for Pricing
View Details
MDL 27324
MBS5775513 Inquire

MDL 27324

Sign In for Pricing
View Details
CTNNAL1 Protein Vector (Mouse) (pPM-C-His)
PV168753 500 ng

CTNNAL1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
MLPH Polyclonal Antibody
MBS129843-01 0.02 mL

MLPH Polyclonal Antibody

Sign In for Pricing
View Details