Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlx1 Peptide - C-terminal region

Dlx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC189409

UniProt

G3V669

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlx1 Rabbit Polyclonal Antibody (orb577401) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001094001

Preservative

Lyophilized powder

AA Sequence

SAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-TSR1 Antibody, Affinity Purified
MBS3905260-01 0.01 mg

Rabbit anti-TSR1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TSR1 Antibody, Affinity Purified
MBS3905260-02 0.1 mg

Rabbit anti-TSR1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TSR1 Antibody, Affinity Purified
MBS3905260-03 5x 0.01 mg

Rabbit anti-TSR1 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-TSR1 Antibody, Affinity Purified
MBS3905260-04 5x 0.1 mg

Rabbit anti-TSR1 Antibody, Affinity Purified

Sign In for Pricing
View Details
BAK Antibody
MBS9600057-01 0.1 mL

BAK Antibody

Sign In for Pricing
View Details
BAK Antibody
MBS9600057-02 0.2 mL

BAK Antibody

Sign In for Pricing
View Details