Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adamts4 Peptide - N-terminal region

Adamts4 Peptide - N-terminal region

Product Specifications

UniProt

Q9ESP7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Adamts4 Rabbit Polyclonal Antibody (orb578110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076449

Preservative

Lyophilized powder

AA Sequence

ASLLPLAWSASPLPREEEIVFPEKLNGSSIIPGSGVPARLLYRLPAFGEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPAS4 Antibody : FITC (OAAF03924-FITC)
OAAF03924-100UG-FITC 100 µg

NPAS4 Antibody : FITC (OAAF03924-FITC)

Sign In for Pricing
View Details
Human CD97/ADGRE5 ELISA Kit PicoKine®
EK1402 96 Well With Removable Strips

Human CD97/ADGRE5 ELISA Kit PicoKine®

Sign In for Pricing
View Details
Rat Activin A (ACVA) CLIA Kit
abx490002-01 96 Tests

Rat Activin A (ACVA) CLIA Kit

Sign In for Pricing
View Details
Rat Activin A (ACVA) CLIA Kit
abx490002-02 5x 96 Tests

Rat Activin A (ACVA) CLIA Kit

Sign In for Pricing
View Details
Rat Activin A (ACVA) CLIA Kit
abx490002-03 10x 96 Tests

Rat Activin A (ACVA) CLIA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710366 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details