Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adamts4 Peptide - N-terminal region

Adamts4 Peptide - N-terminal region

Product Specifications

UniProt

Q9ESP7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Adamts4 Rabbit Polyclonal Antibody (orb578110) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076449

Preservative

Lyophilized powder

AA Sequence

ASLLPLAWSASPLPREEEIVFPEKLNGSSIIPGSGVPARLLYRLPAFGEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX10 AAV Vector (Rat) (CMV)
17792106 1 µg

DDX10 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
Javanicin C
MBS5781852 Inquire

Javanicin C

Sign In for Pricing
View Details
Anti-Septin 12 (SEPT12)
FY-AB45677-01 1 mL

Anti-Septin 12 (SEPT12)

Sign In for Pricing
View Details
Anti-Septin 12 (SEPT12)
FY-AB45677-02 100 µL

Anti-Septin 12 (SEPT12)

Sign In for Pricing
View Details
Anti-Septin 12 (SEPT12)
FY-AB45677-03 200 µL

Anti-Septin 12 (SEPT12)

Sign In for Pricing
View Details
Small Cell Lung Carcinoma (HRP)
MBS6125718-01 0.1 mL

Small Cell Lung Carcinoma (HRP)

Sign In for Pricing
View Details