Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dkk4 Peptide - C-terminal region

Dkk4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dkk-4, MGC25705

UniProt

Q8VEJ3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dkk4 Rabbit Polyclonal Antibody (orb330238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663567

Preservative

Lyophilized powder

AA Sequence

RTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C10orf82 (NM_144661) Human Recombinant Protein
TP306202L 1 mg

C10orf82 (NM_144661) Human Recombinant Protein

Sign In for Pricing
View Details
SMRP1 (C9orf24) (NM_032596) Human Recombinant Protein
TP305959 20 µg

SMRP1 (C9orf24) (NM_032596) Human Recombinant Protein

Sign In for Pricing
View Details
Apolipoprotein E Recombinant Rabbit Monoclonal Antibody [SC0536]
ET1610-22 100 µL

Apolipoprotein E Recombinant Rabbit Monoclonal Antibody [SC0536]

Sign In for Pricing
View Details
ATP5ME Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]
TA811780AM 100 µL

ATP5ME Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS620458 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
H-Resorcinol[Spectrophotometric reagent for the determination of B by FIA]
TRC-R145303-250MG 250 mg

H-Resorcinol[Spectrophotometric reagent for the determination of B by FIA]

Sign In for Pricing
View Details