Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dkk4 Peptide - C-terminal region

Dkk4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Dkk-4, MGC25705

UniProt

Q8VEJ3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dkk4 Rabbit Polyclonal Antibody (orb330238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663567

Preservative

Lyophilized powder

AA Sequence

RTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp414 Mouse Gene Knockout Kit (CRISPR)
KN519827 1 Kit

Zfp414 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Buccutite™ MTA, NHS ester
5355-AAT 2 µmole

Buccutite™ MTA, NHS ester

Sign In for Pricing
View Details
OR9G9 Human Gene Knockout Kit (CRISPR)
KN420784 1 Kit

OR9G9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyanine 555-dUTP, lyophilized powder
#40064 1x 25 nmol

Cyanine 555-dUTP, lyophilized powder

Sign In for Pricing
View Details
Human CFHR5 activation kit by CRISPRa
GA113046 1 Kit

Human CFHR5 activation kit by CRISPRa

Sign In for Pricing
View Details
Eptinezumab Biosimilar - Research Grade
ICH5044-100mg 100 mg

Eptinezumab Biosimilar - Research Grade

Sign In for Pricing
View Details