Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnck Peptide - C-terminal region

Pnck Peptide - C-terminal region

Product Specifications

Product Name Alternative

Camk1b

UniProt

O70150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnck Rabbit Polyclonal Antibody (orb581475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058971

Preservative

Lyophilized powder

AA Sequence

QKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5F (NM_014937) Human Recombinant Protein
TP311091M 100 µg

INPP5F (NM_014937) Human Recombinant Protein

Sign In for Pricing
View Details
Ccl6 Mouse Gene Knockout Kit (CRISPR)
KN502796 1 Kit

Ccl6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arp3 (ACTR3) Mouse Monoclonal Antibody [Clone ID: OTI5G4]
CF812199 100 µg

Arp3 (ACTR3) Mouse Monoclonal Antibody [Clone ID: OTI5G4]

Sign In for Pricing
View Details
CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI5B10]
CF805952 100 µg

CDKL1 Mouse Monoclonal Antibody [Clone ID: OTI5B10]

Sign In for Pricing
View Details
L3HYPDH Antibody
KC-22881-01 50 μL

L3HYPDH Antibody

Sign In for Pricing
View Details
L3HYPDH Antibody
KC-22881-02 100 µL

L3HYPDH Antibody

Sign In for Pricing
View Details