Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnck Peptide - C-terminal region

Pnck Peptide - C-terminal region

Product Specifications

Product Name Alternative

Camk1b

UniProt

O70150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pnck Rabbit Polyclonal Antibody (orb581475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058971

Preservative

Lyophilized powder

AA Sequence

QKNFARTHWKRAFNATSFLRHIRKLGQSPEGEEASRQGMTRHSHPGLGTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF14 (NM_001099854) Human Over-expression Lysate
LC420543 20 µg

PRAMEF14 (NM_001099854) Human Over-expression Lysate

Sign In for Pricing
View Details
NFκB-p105/p50 Polyclonal Antibody
E-AB-32226-01 20 µL

NFκB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
NFκB-p105/p50 Polyclonal Antibody
E-AB-32226-02 60 µL

NFκB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
NFκB-p105/p50 Polyclonal Antibody
E-AB-32226-03 120 µL

NFκB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
NFκB-p105/p50 Polyclonal Antibody
E-AB-32226-04 200 µL

NFκB-p105/p50 Polyclonal Antibody

Sign In for Pricing
View Details
Endothelin 1 Recombinant Rabbit monoclonal Antibody
HA723770 100 µL

Endothelin 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details